CDS

Accession Number TCMCG078C13397
gbkey CDS
Protein Id KAG0472851.1
Location complement(11709329..11709502)
Organism Vanilla planifolia
locus_tag HPP92_014708

Protein

Length 57aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA633886, BioSample:SAMN14973820
db_source JADCNL010000007.1
Definition hypothetical protein HPP92_014708 [Vanilla planifolia]
Locus_tag HPP92_014708

EGGNOG-MAPPER Annotation

COG_category O
Description E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko04121        [VIEW IN KEGG]
KEGG_ko ko:K04506        [VIEW IN KEGG]
EC 2.3.2.27        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko04013        [VIEW IN KEGG]
ko04115        [VIEW IN KEGG]
ko04120        [VIEW IN KEGG]
ko04310        [VIEW IN KEGG]
map04013        [VIEW IN KEGG]
map04115        [VIEW IN KEGG]
map04120        [VIEW IN KEGG]
map04310        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0004842        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009894        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010506        [VIEW IN EMBL-EBI]
GO:0016241        [VIEW IN EMBL-EBI]
GO:0016567        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0019787        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031329        [VIEW IN EMBL-EBI]
GO:0032446        [VIEW IN EMBL-EBI]
GO:0033043        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042802        [VIEW IN EMBL-EBI]
GO:0042803        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044087        [VIEW IN EMBL-EBI]
GO:0044088        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046983        [VIEW IN EMBL-EBI]
GO:0048518        [VIEW IN EMBL-EBI]
GO:0048583        [VIEW IN EMBL-EBI]
GO:0048584        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051128        [VIEW IN EMBL-EBI]
GO:0061630        [VIEW IN EMBL-EBI]
GO:0061659        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070647        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0080134        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1902115        [VIEW IN EMBL-EBI]
GO:1902584        [VIEW IN EMBL-EBI]
GO:2000070        [VIEW IN EMBL-EBI]
GO:2000785        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGCGCAACTGATATGGCAAGGGGTGCCAAGAAGCATCAGGGATGGCCACAAGAAGGTCCAGACAGTCACGATGGCCTCATCGTCCACCGAAACATGGCCATGTTCTTCTCTGGCGGAAGCCGGCAGGAGTTGAAGCTTCGAGTCACCGGCCGAATCTGGAAAGAAGAATGA
Protein:  
MGATDMARGAKKHQGWPQEGPDSHDGLIVHRNMAMFFSGGSRQELKLRVTGRIWKEE